PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00049812-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family Nin-like
Protein Properties Length: 486aa    MW: 53577.2 Da    PI: 5.7305
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00049812-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK894e-28325374352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        +is ++ls+yFs+pi++AA+eL+v+lTvLK++CR++GI+RWPhRk+ksl
  PSME_00049812-RA 325 TDISYSELSQYFSMPITQAARELKVGLTVLKKKCREFGIPRWPHRKMKSL 374
                       689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.713310394IPR003035RWP-RK domain
PfamPF020421.1E-22327374IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MKPLKEDPDS RNSDHEFWQS ILDGLDEAFV IAEPIDTINS SELCEISPDR SWAAAEQHLE  60
FQDHGKQLLG NNYGLVQALS DPSEVLEPVT GCTDHPKDHP HAHAQANWNL VEVPTNETCT  120
NSNIKLTEAV GNLKVEPGNA FSEGTPELSP HIFENLDFCS LPSFSSIKGG MPALPTPNSI  180
TEGLDPQMCN TKPEALISYH DNSIMGMIRC NLSGEIRHAG QVNEVMIAGG LPDQLAGNVD  240
ERMSGGLCWD QLQGYCKNSL SHHKLLPISS NLIEGMAAKH SIEDQPGPSS RSWSRLNQLC  300
ESRPMNATRK EAVMPLSGPV ERNNTDISYS ELSQYFSMPI TQAARELKVG LTVLKKKCRE  360
FGIPRWPHRK MKSLESLIHN IQELSKTNGG LSQARLSNAV QILEEQKKLM EESPGIELAE  420
RTKRLRQACF KANYKKRRQM MCAGRIANNN NNSDTSSSSN QVTEFPPQPS TCSSISDCSG  480
SISSLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.15e-40RWP-RK domain-containing protein